top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|68859883|68863061|+|2|circRNA|TANGO6|ENST00000564180.1|2,3

TANGO6

Open Reading Frame (ORF)

LRDMLDQVYQPLAVRELLILQGGPPQARAQVHYRSQNMMSCWLL

Peptide

ELLILQGGPPQAR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page