top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|68815622|68822038|+|1|new|CDH1|ENST00000261769|6416|0

CDH1

Open Reading Frame (ORF)

MKPPSLCLLKREWKCPRTLAWARKSHPTLPRSQTHLWNRK

Peptide

CPRTLAWAR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Novel in Short-Read

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page