top of page

CircRNA

Gene

chr16|68808423|68810341|+|3|circRNA|CDH1|ENST00000261769.9|4,5,6

CDH1

Open Reading Frame (ORF)

MEILITVTDQNDNKPEFTQEVFKGSVMEGALPGLRFWNPSRIAHISQLLSWPQKTEERLGYSSHQLPRK

Peptide

GSVMEGALPGLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page