top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|67544298|67544830|+|2|circRNA|FAM65A|NM_024519|15,16

FAM65A

Open Reading Frame (ORF)

LGPCAARRHGPWSGCCGKPEYWRQYASSAGGGRSRPALPRKASKQPGGWG

Peptide

QYASSAGGGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page