top of page

CircRNA

Gene

chr16|67036638|67082308|+|3|circRNA|CBFB|NM_022845|3,4,5

CBFB

Open Reading Frame (ORF)

LKRLGEGHANLKIETGLIGRKWRLLWPQEPICLSSFFRPAGRENSDKHLAESMST

Peptide

HLAESMST

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page