top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|66622061|66623502|-|2|circRNA|CMTM4|ENST00000330687.8|4,3

CMTM4

Open Reading Frame (ORF)

MTTSEPARSPGMWTVALRSSAWTRFGQHWTQRFPFLYCFNRTGCFKP

Peptide

MTTSEPAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page