top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|58599235|58599511|—|1|circRNA|CNOT1|NM_001265612|2

CNOT1

Open Reading Frame (ORF)

LLPPQPAMNLDSLSLALSQISYLVDNLTKKNYRASQQEIQHVPCFRTE

Peptide

ASQQEIQHVPCFRTE

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page