top of page

CircRNA

Gene

chr16|53461740|53462655|+|2|circRNA|RBL2|ENST00000262133.10|10,11

RBL2

CircRNA UID

circRBL2(10,11)

Open Reading Frame (ORF)

MLYYKVLESVIEQEQKRLGDMDLSDMFQRSNPGYC

Peptide

LGDMDLSDMFQR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page