top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|53285595|53308854|+|10|circRNA|CHD9|ENST00000447540.5|25,26,27,28,29,30,31,32,33,34

CHD9

Open Reading Frame (ORF)

LLRKDHLMVKTVLWGSSSTSLGFESFKVHQRPASSISQNPYQYQ

Peptide

TVLWGSSSTSLGFESFK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page