top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|4813736|4832912|-|8|circRNA|GLYR1|ENST00000589389.5|10,9,8,7,6,5,4,3

GLYR1

Open Reading Frame (ORF)

LVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQCLDQSGTAEAISCS

Peptide

CLDQSGTAEAISCS

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page