top of page

CircRNA

Gene

chr16|47237964|47313823|-|5|circRNA|ITFG1|ENST00000320640.10|13,12,11,10,9

ITFG1

CircRNA UID

circITFG1(13,12,11,10,9)

Open Reading Frame (ORF)

LCSNDCPRKITMEMDTWIIYCQAVKIKIAKRVPST

Peptide

ITMEMDTWIIYCQAVK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

10

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page