top of page

CircRNA

Gene

chr16|4700969|4702242|-|3|circRNA|ANKS3|ENST00000614075.4|9,8,7

ANKS3

CircRNA UID

circANKS3(9,8,7)

Open Reading Frame (ORF)

LTASGLPALQLTGKAFSLSPAPRLRGPPTQDPRAGSSPWLCHLQQQWREPPGRRGPLLPGCHLPHQ

Peptide

AFSLSPAPRLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page