top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|4650364|4665151|+|6|circRNA|MGRN1|ENST00000262370.11|2,3,4,5,6,7

MGRN1

Open Reading Frame (ORF)

LAAFEKETTLLRTFSWEERNSTPPTLKVTSLERTWI

Peptide

LAAFEKETTLLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page