top of page

CircRNA

Gene

chr16|4463659|4469465|-|3|circRNA|NMRAL1|NM_001305141|5,4,3

NMRAL1

CircRNA UID

circNMRAL1(5,4,3)

Open Reading Frame (ORF)

LPCSPSTPARSCTMPRCPGWLRGPHTPGRWDIQGSSGDPKP

Peptide

LPCSPSTPARSCTMPR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC

NA

Potential Cryptic Translation

false

bottom of page