top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|4261968|4262323|—|1|ciRNA|TFAP4|NM_003223|3

TFAP4

Open Reading Frame (ORF)

LLCKAAHSPGIWLVCWTCRRGSLMKIHLCWAALGGCDGTPISVVVPRCQAH

Peptide

GSLMKIHLCWAALGGCDGTPISVVVPR

ORF Found in Long-Read

true

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page