top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|31493073|31493466|—|1|ciRNA|C16orf58|ENST00000570164.5|9

C16orf58

Open Reading Frame (ORF)

LFSGWLGMPAFAVLHPVSGLASPARHHRHPHSPHSDYTLASLARPHLSVLGSSLLLNRHGVGVGV

Peptide

HGVGVGV

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page