top of page

CircRNA

Gene

chr16|30768837|30772190|+|5|circRNA|RNF40|NM_001207033|15,16,17,18,19

RNF40

CircRNA UID

circRNF40(15,16,17,18,19)

Open Reading Frame (ORF)

MPTKSSRRRSRSTRLMSCGAASGNWRRGIEGRARRSRMRMPCGAFGRQRSR

Peptide

LMSCGAASGNWR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page