top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|29977737|29986504|+|15|circRNA|TAOK2|NM_001252043|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16

TAOK2

Open Reading Frame (ORF)

LSSPACSTRRSWATSWSTTSGVSKSCGRSMRPRFASSPRASKPGPTLRAPRGHHASWGPGREPEGPRCG

Peptide

APRGHHASWGPGR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page