top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|29910977|29911867|-|2|circRNA|KCTD13|ENST00000308768.9|5,4

KCTD13

Open Reading Frame (ORF)

MTTYLRTSSCSTSWPCASTGGYSSSRMSWGTRSAAGLSTGRAAKSPRCAAPPLSMLRRRSRPSPW

Peptide

MSWGTRSAAGLSTGR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page