top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|29833732|29842112|+|7|circRNA|MVP|ENST00000395353.5|4,5,6,7,8,9,10

MVP

Open Reading Frame (ORF)

LSWCRWVLRSSSQCCPSQLGGPSVPMPAVRSACCWGLTSSQTSSPSKRRIMPGCNCSWPTTGHHTPAGGSAQHCPPSKGAA

Peptide

WVLRSSSQCCPSQLGGPSVPMPAVR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page