top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|27528597|27545523|—|5|circRNA|GTF3C1|ENST00000561623.5|6,5,4,3,2

GTF3C1

Open Reading Frame (ORF)

LCERTFKRLYQYMLNAGLAKVVSLRLQEIHPECGPCKTKKGMKKLIWKLEFWSLGGTRWLWRMSTPFI

Peptide

LIWKLEFWSLGGTR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page