top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|27494762|27495492|—|2|circRNA|GTF3C1|ENST00000561623.5|16,15

GTF3C1

Open Reading Frame (ORF)

MSTMPRGCATSPQSQSTGTSALAGLSSATSSSAFPSPSSSRLCKSATSSRTGAFSRISAQNASPAGGPHVSVVPHLRAPCQQHRGEAKLHQ

Peptide

SATSSRTGAFSR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page