top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|27346466|27355907|+|3|circRNA|IL4R|NM_000418|6,7,8

IL4R

Open Reading Frame (ORF)

LLGVSVSCIVILAVCLLCYVSITNETQGPRKPDSSHQCLRHSAADLEQPVSP

Peptide

KPDSSHQCLRHSAADLEQPVSP

ORF Found in Long-Read

true

Peptide Length

22

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page