top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|24822147|24822872|+|1|ciRNA|TNRC6A|ENST00000315183.11|22

TNRC6A

Open Reading Frame (ORF)

LACALLWRLGVELPPPSSLREQNLDGCCPQGREERRHGATVGIWGVSRSLEARAVWLWEQWRWGRWLCTPSEQRQSVSEEWCQEHRASGKRGGAAVQPETASWRARGDASHWQFPHCFLVRIPDTLVYVATPGSMGTEVRVCM

Peptide

IPDTLVYVATPGSMGTEVRVCM

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page