top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|19669159|19691471|+|3|circRNA|C16orf62|ENST00000438132.7|27,28,29

C16orf62

Open Reading Frame (ORF)

LAENNKLCETVMAQILEHLKTLAKDELMLFSKPL

Peptide

TLAKDELMLFSKPL

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page