top of page

CircRNA

Gene

chr16|19642395|19652090|+|5|circRNA|C16orf62|ENST00000438132.7|22,23,24,25,26

C16orf62

CircRNA UID

circC16orf62(22,23,24,25,26)

Open Reading Frame (ORF)

LPTASSPSPPWRASSHVSISTCILVRWPWPTSASPKASTRAHQGPGHLECPFACLQDHA

Peptide

WPWPTSASPKASTR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page