top of page

CircRNA

Gene

chr16|16007815|16016621|+|4|circRNA|ABCC1|ENST00000399410.7|2,3,4,5

ABCC1

Open Reading Frame (ORF)

MPRWTCFVTSLSTSTFPSYSFSSSCPVSQIAHPCSRKPSTTLTGMSRGIPATPTSPSAFRTRSSCGCLVFTSGPVSPSTSSISPDMTEATFR

Peptide

KPSTTLTGMSR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page