top of page

CircRNA

Gene

chr16|1518357|1519880|-|1|ciRNA|IFT140|ENST00000361339.9|11

IFT140

CircRNA UID

ciIFT140(11)

Open Reading Frame (ORF)

LTTRNPSQQKGRTADGSSLGTALLLKTHPTSSWEPSEPGHSLGKVFWKHQRR

Peptide

TADGSSLGTALLLK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page