top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|11886470|11887750|—|3|circRNA|GSPT1|ENST00000434724.6|9,8,7

GSPT1

Open Reading Frame (ORF)

LASIPKRTFTLCPAQDLLEQISKSSRISVLGTCTCLGP

Peptide

LASIPKR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page