top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|10428867|10431455|+|2|circRNA|ATF7IP2|ENST00000396559.5|3,4

ATF7IP2

Open Reading Frame (ORF)

LFIQKQNWNKLFVRTKSQVEQQNPPAESSQKRQKIH

Peptide

TKSQVEQQNPPAESSQK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page