top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|92901166|92924552|+|2|circRNA|RP11-437B10.1|ENST00000629685.2|5,6

RP11-437B10.1

Open Reading Frame (ORF)

LKKLRVQTQAVSRKVSREVIQEVDMAASRTAALNLLRVSRNLRANQQVPNPSQSSQKPKRSQPLRRNG

Peptide

TAALNLLR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page