top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|92120464|92128489|+|3|circRNA|SLCO3A1|ENST00000318445.10|5,6,7

SLCO3A1

Open Reading Frame (ORF)

LAQPWTPTRPAIITVNAKPIPSLQCVGQMASPTCLPALLAATARDPEGHQAPALKPCVHLHHPGRLHGDCSGGWLRCLFGEVPGAAV

Peptide

CLFGEVPGAAV

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page