top of page

CircRNA

Gene

chr15|89281169|89293997|+|9|circRNA|FANCI|ENST00000300027.12|15,16,17,18,19,20,21,22,23

FANCI

CircRNA UID

circFANCI(15,16,17,18,19,20,21,22,23)

Open Reading Frame (ORF)

LSLFMCYKKLSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALFRPAFKYRHVCTLSSSKLFF

Peptide

HVCTLSSSKLFF

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page