top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|84680712|84691644|—|3|circRNA|SEC11A|NM_001271918|5,4,3

SEC11A

Open Reading Frame (ORF)

LTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGSIIKS

Peptide

ARGSIIK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page