top of page

CircRNA

Gene

chr15|84202869|84204975|-|5|circRNA|GOLGA2P7|NR_027001|6,5,4,3,2

GOLGA2P7

Open Reading Frame (ORF)

LALGTPRLGAGYLPWQHGSDCMTGGIFQLRWSQCPGGTKGVLPAPGSPSGLVPEEARGSGPSPREWG

Peptide

GSGPSPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page