top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|81341561|81362036|+|3|circRNA|TMC3—AS1|NR_120365|3,4,5

TMC3-AS1

Open Reading Frame (ORF)

LILSGFALYLTEGMNWERTAEPQRNVERPTSRLFPFCLSPRTMEAPCRNMVLTLWGLYPKLKGLEKPLKSRDHNPPPSKDKTSH

Peptide

TMEAPCR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page