top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|78541930|78542176|+|1|ciRNA|PSMA4|ENST00000560217.5|2

PSMA4

Open Reading Frame (ORF)

LSVSSHLLNFVYQDRFCKIICRLAGVGLLSVGRNHSCVFPLQVS

Peptide

LAGVGLLSVGRNHSCVFPLQVS

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page