top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|75605149|75621056|—|6|circRNA|SNUPN|ENST00000567134.5|8,7,6,5,4,3

SNUPN

Open Reading Frame (ORF)

LISDSTGCIQSYQKKKDWERKPSLILEDGRVESGPG

Peptide

LISDSTGCIQSYQK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page