top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|75422646|75430408|—|2|circRNA|SIN3A|NM_015477|3,2

SIN3A

Open Reading Frame (ORF)

MTRSHRCMQPSSVGSLAAQRLFLTSTGCLPLPLLCMKQCLRPCSQLREFSTL

Peptide

LFLTSTGCLPLPLLCMK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page