top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|72265991|72266744|—|1|ciRNA|PARP6|NM_020214|3

PARP6

Open Reading Frame (ORF)

LESYLFQSKLHPLYVETTHILIRHNYFLTFITLASGGSFIH

Peptide

LHPLYVETTHILIRHNYFLTFITLASGGSFIH

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page