top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|72206727|72219110|-|7|circRNA|PKM|NM_001206799|8,7,6,5,4,3,2

PKM

Open Reading Frame (ORF)

MLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLDLSSHVEAP

Peptide

GDYPLEAVRMQHLDLSSHVEAP

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page