top of page

CircRNA

Gene

chr15|71991102|72032588|-|9|circRNA|MYO9A|ENST00000356056.9|11,10,9,8,7,6,5,4,3

MYO9A

CircRNA UID

circMYO9A(11,10,9,8,7,6,5,4,3)

Open Reading Frame (ORF)

LVFLIFLGLKIMKITALNSSVLILLMNVYSTTLISISLNWNKPLEMQRQLIITIQVVLGSLFK

Peptide

IMKITALNSSVLILLMNVYSTTLISISLNWNKPLEMQR

ORF Found in Long-Read

false

Peptide Length

38

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page