top of page

CircRNA

Gene

chr15|69210315|69261329|+|3|circRNA|GLCE|ENST00000261858.6|2,3,4

GLCE

CircRNA UID

circGLCE(2,3,4)

Open Reading Frame (ORF)

MKQQKTETKTSLMTGLCQRAALWRMWLISLDSPMSNSLLHQEFDKKLKF

Peptide

MWLISLDSPMSNSLLHQEFDK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page