top of page

CircRNA

Gene

chr15|67164894|67165384|+|2|circRNA|SMAD3|ENST00000559460.5|2,3

SMAD3

Open Reading Frame (ORF)

LVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPGPWMAGCRCPIGRGSLMSSTAACGDGQTCTATTSYGPWSCVSSPSI

Peptide

HTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPGPWMAGCR

ORF Found in Long-Read

false

Peptide Length

43

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

36

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page