top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|64822265|64824354|-|3|circRNA|PIF1|NM_001286496|4,3,2

PIF1

Open Reading Frame (ORF)

LLSSARRAPLHAFRRGRAQHPAAPRPRHPRGRRSAAAALGLPPRPPAPLPAHIAPQAGCGPGSRAGLRPSAAAGPAAPRLRHHQPCAARGAAAQGGHPGSGHYAGEAACGAPGWGRA

Peptide

HHQPCAARGAAAQGGHPGSGHYAGEAACGAPGWGR

ORF Found in Long-Read

false

Peptide Length

35

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

35

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page