top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|64300318|64300723|-|1|circRNA|CSNK1G1|ENST00000303052.11|2

CSNK1G1

Open Reading Frame (ORF)

LSCRIMDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRLGYKMFT

Peptide

IMDHPSR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page