top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|64204440|64207594|-|3|circRNA|CSNK1G1|ENST00000303052.11|9,8,7

CSNK1G1

Open Reading Frame (ORF)

MSGDWTSLKNLIMSIYGPSSQTSLKRKATPLTMPMIGLGDLLAKPER

Peptide

ATPLTMPMIGLGDLLAKPER

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page