top of page

CircRNA

Gene

chr15|64156172|64156724|—|1|ciRNA|PPIB|ENST00000300026.3|4

PPIB

Open Reading Frame (ORF)

LYLHASKVLNSSSPLRAQPGRLHNCQSLPPLLHSVTCWSHP

Peptide

LYLHASKVLNSSSPLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page