top of page

CircRNA

Gene

chr15|63672495|63694894|-|12|circRNA|HERC1|ENST00000443617.6|39,38,37,36,35,34,33,32,31,30,29,28

HERC1

CircRNA UID

circHERC1(39,38,37,36,35,34,33,32,31,30,29,28)

Open Reading Frame (ORF)

MSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRMGSEQLREIFRLKSR

Peptide

MGSEQLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page