top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|59671182|59680308|—|5|circRNA|BNIP2|ENST00000267859.7|7,6,5,4,3

BNIP2

Open Reading Frame (ORF)

MVQQLEEKCPVWDGSGNVISKLIEDLYQKMIVLKQIY

Peptide

LIEDLYQKMIVLK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page